DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and CDK11A

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001300825.1 Gene:CDK11A / 728642 HGNCID:1730 Length:783 Species:Homo sapiens


Alignment Length:440 Identity:148/440 - (33%)
Similarity:220/440 - (50%) Gaps:76/440 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SHMLQQP----------SGSTPSNVGSSSSRTMSLMEKQKYIED----------YDFPY------ 43
            :|:|..|          |......||..:.::.:|.|.. |:.|          .:.|.      
Human   355 NHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGD-YVPDSPALLPIELKQELPKYLPALQ 418

  Fly    44 -CDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKH 107
             |....:::.:.:|.:||:|.|::|::|| ..:.||:|::.|:.||||||||:||||..:...:|
Human   419 GCRSVEEFQCLNRIEEGTYGVVYRAKDKK-TDEIVALKRLKMEKEKEGFPITSLREINTILKAQH 482

  Fly   108 ENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYI 172
            .|:|.:.||      .........|:|.::.||||..|:..|...|..||:|.:|.|||.|:.::
Human   483 PNIVTVREI------VVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHL 541

  Fly   173 HSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRN 237
            |.|.|||||:|.:|:|::..||||:.||||||.:..|    ...||..|||.|||.||||||.:.
Human   542 HDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSP----LKAYTPVVVTQWYRAPELLLGAKE 602

  Fly   238 YGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKN 302
            |...||||..|||..|:.|:.|:..||:|..|:..:.:..|:.:..:|||..||.:.|.:...::
Human   603 YSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKELGTPSEKIWPGYSELPVVKKMTFSEH 667

  Fly   303 QKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSM 367
            ....:::|....:.|| |.||::|.||..|.:||.|:..|.|::|...|:|.|         .||
Human   668 PYNNLRKRFGALLSDQ-GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPID---------PSM 722

  Fly   368 FEYLAQPRRSNQMR--------------NYHQ-----------QLTTMNQ 392
            |.  ..|.:|.|.|              .|.|           .|||.||
Human   723 FP--TWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQ 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 121/326 (37%)
CDK11ANP_001300825.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..396 9/41 (22%)
STKc_CDC2L1 420..711 CDD:173741 119/302 (39%)
PLN00009 423..713 CDD:177649 119/301 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 721..783 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.