DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk10

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001017622.2 Gene:cdk10 / 550285 ZFINID:ZDB-GENE-050417-94 Length:360 Species:Danio rerio


Alignment Length:338 Identity:135/338 - (39%)
Similarity:193/338 - (57%) Gaps:17/338 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHE 108
            |....::||:.:||:||:|.|::||:.:.| :.||:|||.||.||:|.||::||||.:|..|:|.
Zfish    34 CRSVKEFEKINRIGEGTYGIVYRARDTRTN-EIVALKKVRMDKEKDGIPISSLREINLLIRLRHP 97

  Fly   109 NVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIH 173
            |:|.|.|:      ....:..:.:||..:||.|||.||.||...||..::|.::.|||.||.|:|
Zfish    98 NIVELKEV------VVGSHLESLFLVMSYCEQDLASLLENMQSPFSEAQVKCIVLQLLKGLAYLH 156

  Fly   174 SNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNY 238
            .|.|||||:|.:|:|:|..|.:|:|||||||.:.||...    .|.||||||||.||||||.:..
Zfish   157 HNFILHRDLKVSNLLMTDKGCVKIADFGLARVYGIPLQP----MTPRVVTLWYRAPELLLGTKTQ 217

  Fly   239 GPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQ 303
            ...:|||..|||.||:....|::.|.:|.|||..|.||.|:....:|||...|.|.....|.|..
Zfish   218 TTALDMWAVGCIFAELLAHKPLLPGASEIQQLDLIVQLLGTPNESIWPGFSRLPLVGQYSLRKQP 282

  Fly   304 KRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLS----QHL 364
            ...:|.:..  ...:.|..||:.|...:|::|..|...|...:|...|:|.:...|.:    ::.
Zfish   283 YNNLKNKFT--WLSEAGLRLLNLLFMYNPQRRATAIDCLESSYFKEKPLPCEPELMPTFPHHRNK 345

  Fly   365 QSMFEYLAQPRRS 377
            :|..|...|.:||
Zfish   346 RSASETEHQTKRS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 126/302 (42%)
cdk10NP_001017622.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.