DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and CDK12

DIOPT Version :10

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_057591.2 Gene:CDK12 / 51755 HGNCID:24224 Length:1490 Species:Homo sapiens


Alignment Length:97 Identity:19/97 - (19%)
Similarity:35/97 - (36%) Gaps:36/97 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKIALVTGASSGIGQDVALTLADA---------GMIVV------------GIARRAELVTLLSTK 49
            |...::....:||.....|:|.:|         |..:|            |:...:...|:...:
Human    83 GSAGVMVELCAGIVDQPGLSLEEAACKEAWEECGYRLVPTDLRRVATYMSGVGLTSSRQTMFYAE 147

  Fly    50 VT-------GGGKIYAKKCDVSNEGEIMETLN 74
            ||       |||        ::.|||::|.::
Human   148 VTDAQRGGPGGG--------LAEEGELIEVIH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 10/45 (22%)
CDK12NP_057591.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..703 19/97 (20%)
STKc_CDK12 719..1020 CDD:270847
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1047..1098
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1161..1189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1220..1348
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1441..1460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1466..1490
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.