DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and CG6800

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:303 Identity:107/303 - (35%)
Similarity:165/303 - (54%) Gaps:18/303 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIR 100
            :|||      ..::|:.:.|||:|..|.||||.:.:.||: ||:|||.:.|:.....:..||||:
  Fly     1 MEDY------APSRYKMLEKIGEGVHGCVFKAIDLQRNKE-VAIKKVALKNKFGNIALNTLREIK 58

  Fly   101 ILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQL 165
            .|||.|.|.::::|:|.......:        ||.::....|...|.:.....|..:::|...|:
  Fly    59 TLQLCKSEYILDIIDIYPDLTGLS--------LVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQM 115

  Fly   166 LNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPE 230
            ..|:.|:|...::|||:|.||:||:...:||:|||||||.: .|::||: .|:.:|.|.|||.||
  Fly   116 FKGIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESR-LYSPQVSTRWYRAPE 178

  Fly   231 LLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYK 295
            :|.|.:.||..||||.|||::|||....|:..|.|:.:||..|.:..||...:.||.:..|..|.
  Fly   179 ILFGSQKYGTGVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYS 243

  Fly   296 SIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDA 338
            .|..| |......:.|.|........:|:..|:..:||.|:.|
  Fly   244 KIRFP-NSVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 107/302 (35%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 104/290 (36%)
S_TKc 9..288 CDD:214567 104/289 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.