DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk5

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster


Alignment Length:307 Identity:130/307 - (42%)
Similarity:181/307 - (58%) Gaps:18/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNL 113
            ||:|:.|||:||:|.|||.| .:...:.||:|:|.:|.:.||.|.:|||||.:|:.|||:|:|.|
  Fly     3 KYDKMEKIGEGTYGTVFKGR-NRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVRL 66

  Fly   114 IEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKIL 178
            |::..:....|        |||:.|:.||.....::|.:..:...:..|.|||.||.:.||:.:|
  Fly    67 IDVLHSDKKLT--------LVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVL 123

  Fly   179 HRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVD 243
            |||:|..|:||.|:|.||||||||||||.||    ...|:..|||||||||::|.|.:.|...:|
  Fly   124 HRDLKPQNLLINKNGELKLADFGLARAFGIP----VKCYSAEVVTLWYRPPDVLFGAKLYTTSID 184

  Fly   244 MWGAGCIMAEMWTRS-PIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRV 307
            ||.||||:||:.... |:..|:....||..|.::.|:...|.||||..|..|  :.||.......
  Fly   185 MWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDY--VALPSFPAITS 247

  Fly   308 KERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPS 354
            ..:|.|.:..: |.|||.|||...|.:||.|:.|:.|.:| ||...|
  Fly   248 WSQLVPRLNSK-GRDLLQKLLICRPNQRISAEAAMQHPYF-TDSSSS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 126/298 (42%)
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 127/301 (42%)
STKc_CDK5 3..286 CDD:143344 126/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.