DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and Cdk7

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:317 Identity:120/317 - (37%)
Similarity:175/317 - (55%) Gaps:28/317 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKV---LMDNEKEGFPITALREIRILQLLK 106
            |::.:|.|::.:|:|.|..|:|||:...| :.||:||:   ..::.::|...||||||:|||.|:
  Fly     7 DKTERYAKLSFLGEGQFATVYKARDTVTN-QIVAVKKIKKGSREDARDGINRTALREIKILQELQ 70

  Fly   107 HENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYY 171
            |||::.|:::.        |..|...|||||.:.||..::.:..:..:...||......|.||.|
  Fly    71 HENIIGLVDVF--------GQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEY 127

  Fly   172 IHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNR-YTNRVVTLWYRPPELLLGD 235
            :|.|.|||||:|..|:|:...||||:.|||||::|..|     || ||:.|||.|||.||||.|.
  Fly   128 LHLNWILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSP-----NRIYTHHVVTRWYRSPELLFGA 187

  Fly   236 RNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELP 300
            |.||..||||..|||:||:..|.|.|.|:::..|||.|....|:.|...||.:.:|..|.     
  Fly   188 RQYGTGVDMWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYL----- 247

  Fly   301 KNQKRRVKERLRPYVKDQTGCD---LLDKLLTLDPKKRIDADTALNHDFFWTDPMPS 354
              |.|.........:....|.|   |:.:|..::|.:|:....||:..:|...|.|:
  Fly   248 --QFRNFPGTPLDNIFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPT 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 117/308 (38%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 120/317 (38%)
STKc_CDK7 11..308 CDD:270833 119/313 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.