DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk-12

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001367220.1 Gene:cdk-12 / 175559 WormBaseID:WBGene00007135 Length:734 Species:Caenorhabditis elegans


Alignment Length:365 Identity:151/365 - (41%)
Similarity:221/365 - (60%) Gaps:38/365 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DYDFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRIL 102
            |.|..|......|..:.:||:||:|:|:||......:: ||:|:|.::||||||||||:|||:||
 Worm   299 DSDSWYKTNLTHYTMLDQIGEGTYGQVYKAVNNLTGEQ-VALKRVRLENEKEGFPITAIREIKIL 362

  Fly   103 QLLKHENVVNLIEIC-------RTKATATNGYRSTFYLVFDFCEHDLAGLLSNMN-VKFSLGEIK 159
            :.|.|:|:|.|::|.       ..|.|     |:.|||||::.:|||.|||.:.. |.|:..:|.
 Worm   363 RQLHHKNIVRLMDIVIDDISMDELKRT-----RANFYLVFEYVDHDLIGLLESKELVDFNKDQIC 422

  Fly   160 KVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNR-YTNRVVT 223
            .:.:|||.||.|||:...||||:|.:|:|:...|.||:||.||||.:     |.::| |||||:|
 Worm   423 SLFKQLLEGLAYIHNTGFLHRDIKCSNILVNNKGELKIADLGLARLW-----EKESRLYTNRVIT 482

  Fly   224 LWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGV 288
            ||||||||||||..|||.:|:|..||::.|::||.|:..||.|..||..||::|||...|.||.:
 Worm   483 LWYRPPELLLGDERYGPAIDVWSTGCMLGELFTRKPLFNGNNEFGQLELISKVCGSPNVDNWPEL 547

  Fly   289 EELELYKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMP 353
            .||..:.:..:.:..:||::|... ::..:...|||||:|||:|:|||.|..||||.  |     
 Worm   548 TELVGWNTFRMKRTYQRRIREEFE-HIMPREAVDLLDKMLTLNPEKRISAKEALNHP--W----- 604

  Fly   354 SDLSKMLSQHLQSMFEYLAQPRRSNQMRNYHQQLTTMNQK 393
                      ::|:.....||.:..|.::.|:..:...:|
 Worm   605 ----------IRSLEHTTVQPLKLPQHQDCHEMWSKKQKK 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 144/317 (45%)
cdk-12NP_001367220.1 STKc_CDK12 303..605 CDD:270847 143/330 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D344403at33208
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.