DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and cdk13

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001353758.1 Gene:cdk13 / 108178997 ZFINID:ZDB-GENE-030131-4975 Length:1289 Species:Danio rerio


Alignment Length:341 Identity:153/341 - (44%)
Similarity:214/341 - (62%) Gaps:20/341 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVN 112
            :|:|.:...|:||:|:|:||:: |...:.||:|||.:|||||||||||:|||:||:.|.|::::|
Zfish   592 DKFEIIGITGEGTYGQVYKAKD-KDTAELVALKKVRLDNEKEGFPITAIREIKILRQLNHKSIIN 655

  Fly   113 LIEICRTKATATN--GYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSN 175
            :.||...|..|.:  ..:..|||||::.:|||.|||.:..|.|:...||..|:|||.||.|.|..
Zfish   656 MKEIVTDKEDALDFKNDKGAFYLVFEYMDHDLMGLLESGLVHFNESHIKSFMRQLLEGLDYCHKK 720

  Fly   176 KILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGP 240
            ..||||:|.:|:|:...|.:|||||||||.::   :|....|||:|:||||||||||||:..|.|
Zfish   721 NFLHRDIKCSNILLNNKGQIKLADFGLARLYN---SEESRPYTNKVITLWYRPPELLLGEERYTP 782

  Fly   241 PVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKR 305
            .:|:|..|||:.|::|:.||.|.|.|..||..||::|||..|.|||.|.:|..:.:::..|..:|
Zfish   783 AIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRR 847

  Fly   306 RVKERLR--PYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFW-TDPM---PSDLSKMLSQHL 364
            |::|...  |.:    ..||.|.:|.|||.||..|:.|||.||.. .||.   |.||.  |.|..
Zfish   848 RLREEFAFIPLM----ALDLFDHMLALDPSKRCTAEQALNSDFLRDVDPAKMPPPDLP--LWQDC 906

  Fly   365 QSMFEYLAQPRRSNQM 380
            ..::.  .:.||..||
Zfish   907 HELWS--KKRRRQKQM 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 141/302 (47%)
cdk13NP_001353758.1 STKc_CDK12 586..887 CDD:270847 141/302 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D344403at33208
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.