DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and CRG1

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_012079.1 Gene:CRG1 / 856616 SGDID:S000001252 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:44/172 - (25%)
Similarity:66/172 - (38%) Gaps:44/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 HFSETRHT-PWPQVSEFLDSFE-PQSVVLDIGCGNGK-YLSCNPLLLSV-GCDRAQGLLAVGRRK 434
            |::..|.: |...|:|.:...: .:..::|||||.|| .....|....| |.|.:..:|::. .|
Yeast    15 HYNNVRPSYPLSLVNEIMKFHKGTRKSLVDIGCGTGKATFVVEPYFKEVIGIDPSSAMLSIA-EK 78

  Fly   435 GQNVFRCDCLV----VP------VRSSSIDGCISIAVIHHLATKERRLAALQEMARVLRPGG--- 486
            ..|..|.|..:    .|      :|..|:|..||...| |....||   ..|:::.:||..|   
Yeast    79 ETNERRLDKKIRFINAPGEDLSSIRPESVDMVISAEAI-HWCNLER---LFQQVSSILRSDGTFA 139

  Fly   487 -------------RAL----VYVWAKDQRKNDKKSTYLRQNK 511
                         .||    .|.|:||.     ...||..|:
Yeast   140 FWFYIQPEFVDFPEALNVYYKYGWSKDY-----MGKYLNDNQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 32/121 (26%)
CRG1NP_012079.1 Methyltransf_11 43..140 CDD:400514 30/101 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.