DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and TRM9

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_013698.1 Gene:TRM9 / 854994 SGDID:S000004476 Length:279 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:95/263 - (36%)
Similarity:139/263 - (52%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 QAITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLSV 419
            ||...||:.||:||::||.|||:||:.|||.|::||.:....|:.:|:||||||||..||.:..:
Yeast     5 QAAEKEQEYVHKVYNEIAPHFSQTRYKPWPIVTQFLKTRPMGSIGIDVGCGNGKYLGVNPDIYII 69

  Fly   420 GCDRAQGLL--AVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVL 482
            |.||:.||:  |.|.....|:...|.|.:|.::.:.|..|||||:||.:|:|||:..::.:...|
Yeast    70 GSDRSDGLIECARGINPSYNLLVADGLNLPHKNETFDFAISIAVVHHWSTRERRVEVIRHVLSKL 134

  Fly   483 RPGGRALVYVWA-------------------------KDQRKNDKKSTYLRQNKA------VN-- 514
            |.||:||:|.||                         |.:.|...|||...:.|.      :|  
Yeast   135 RQGGQALIYCWALEQGSSRRGYHEGMEQDVFVPWVLPKSKSKPKTKSTPPAKVKTRPKPNLMNIP 199

  Fly   515 -KERTTEQQQRQKQHQELEQQLSNNNPLPVHTNRTEFQQQDVLVPWKTKDEQKTTYLRYYHVFEE 578
             ||| :|..||.|:.|:..:.|.:|:         |.||||      .:.|::....||||::.|
Yeast   200 PKER-SEYLQRWKEEQQRSKSLDDND---------EKQQQD------QEQEREEVKYRYYHLYRE 248

  Fly   579 QEL 581
            .||
Yeast   249 GEL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 39/91 (43%)
TRM9NP_013698.1 Methyltransf_25 51..138 CDD:404528 36/86 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345844
Domainoid 1 1.000 80 1.000 Domainoid score I2016
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44488
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1867
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001370
OrthoInspector 1 1.000 - - oto99628
orthoMCL 1 0.900 - - OOG6_100549
Panther 1 1.100 - - LDO PTHR13069
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1711
SonicParanoid 1 1.000 - - X865
TreeFam 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.