DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and ALKBH7

DIOPT Version :10

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_115682.1 Gene:ALKBH7 / 84266 HGNCID:21306 Length:221 Species:Homo sapiens


Alignment Length:198 Identity:50/198 - (25%)
Similarity:82/198 - (41%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 FVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFE-FLYGTNNVDPSKPLEQSIPSACDILW 206
            |::..||.||.|         |:...|:.|..::..:: .::|....:.|:..|     |...:.
Human    39 FLSTAEEETLSR---------ELEPELRRRRYEYDHWDAAIHGFRETEKSRWSE-----ASRAIL 89

  Fly   207 PRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMDF---RRGDDQ 268
            .|:.:.|.....:....:.|.:.|....|.||||:.......|..|||.|..||..   :...:.
Human    90 QRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEW 154

  Fly   269 VQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRLRK--GPCDC 331
            :::.|...||.|:.|.||||::|.|....     .:..|.....||:|.|:..|.|.:  ||.:.
Human   155 LELLLEPGSLYILRGSARYDFSHEILRDE-----ESFFGERRIPRGRRISVICRSLPEGMGPGES 214

  Fly   332 SYP 334
            ..|
Human   215 GQP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:409865
2OG-FeII_Oxy 136..322 CDD:473886 45/182 (25%)
UbiE 368..498 CDD:441828
ALKBH7NP_115682.1 2OG-FeII_Oxy 33..200 CDD:473886 44/179 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.