DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and AT1G36310

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001031144.1 Gene:AT1G36310 / 840538 AraportID:AT1G36310 Length:404 Species:Arabidopsis thaliana


Alignment Length:357 Identity:108/357 - (30%)
Similarity:156/357 - (43%) Gaps:81/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 DTQQTKVPQELHASLAAQAI----TLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSV 398
            |.::..|...:.:|.:..::    .:|::.||.|||.||.|||.||...||:|:.||:|....||
plant    46 DEEEESVSIRVSSSSSLSSVKSTPEIEKKYVHRVYDAIAPHFSSTRFAKWPKVAAFLESLPSGSV 110

  Fly   399 VLDIGCGNGKYLSCNPLLLSVGCDRAQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIH 463
            :||.||||||||..||....:|||.:..|:.:...|||.|...|.:.:|.|....|..|||||:|
plant   111 ILDAGCGNGKYLGLNPSCFFIGCDISHPLIKICSDKGQEVLVADAVNLPYREEFGDAAISIAVLH 175

  Fly   464 HLATKERRLAALQEMARVLRPGGRALVYVWAKDQRK----------------------NDKKSTY 506
            ||:|:.||..|::|:.||::|||..|:.|||.:|..                      :...|..
plant   176 HLSTENRRKKAIEELVRVVKPGGFVLITVWAAEQEDTSLLTKWTPLSAKYVEEWVGPGSPMNSPR 240

  Fly   507 LRQNKAVNKERTTEQQQRQKQHQELEQQLSNNNPLPVHTNRTEFQ-------------------- 551
            :|.|...:.|...|.:...|:.:....|......:|.....|..|                    
plant   241 VRNNPFFSLESIPETEVSTKEQKVENSQFIGLESIPESEESTREQKGESIIPETKASIVEQKDEK 305

  Fly   552 ------------QQDVLVPW---------------------KTKDEQK--TTYLRYYHVFEEQEL 581
                        ||:..|||                     ..||::|  ..|.||||||.|.||
plant   306 SVEESLEALKKSQQEYFVPWHLPYHRAEVSGASASALASGLAKKDDRKGAVVYNRYYHVFSEGEL 370

  Fly   582 ENLVSQVHEVQLIKSYYDQGNHCAIFEKLSNN 613
            |.|.|.|....::..::|:.|.|.:.:|.:.|
plant   371 ERLASGVGNAMIVDRFFDKSNWCIVLQKEALN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 42/89 (47%)
AT1G36310NP_001031144.1 Methyltransf_11 112..202 CDD:311935 42/89 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2645
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D996085at2759
OrthoFinder 1 1.000 - - FOG0001370
OrthoInspector 1 1.000 - - oto4039
orthoMCL 1 0.900 - - OOG6_100549
Panther 1 1.100 - - LDO PTHR13069
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X865
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.