DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and TRM9

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_174442.2 Gene:TRM9 / 840048 AraportID:AT1G31600 Length:431 Species:Arabidopsis thaliana


Alignment Length:359 Identity:125/359 - (34%)
Similarity:166/359 - (46%) Gaps:81/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SPSAEP-TPYLAVLNVGLSNGLTEECL------------LTEAAATGGKVIQVVMLPGKSYCFFI 85
            |.|.|| :..|.|.|.|.:.|||...:            :..|..:|.:||.....|     |..
plant   101 SISGEPNSSNLYVANCGPAVGLTHNAIAAVFAEFGEVNGVYAADDSGVRVIVSFADP-----FSA 160

  Fly    86 CASLEDSQLIYEGMHNISTIGQ-----QGAVAYLSY-IRQLPALAG----------KSEWNKPLP 134
            .|:||            :..|:     :|...::.| :.|||:...          .||.|.|  
plant   161 KAALE------------ALSGRPCPDLKGRSLHIRYSVLQLPSETQVNDCVPVSLIDSELNIP-- 211

  Fly   135 RGLHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSIP 199
             ||.::.||||..||..||.|:  |.|  ...| |..|.|:|:|:||.|||.|||..|.|.: :|
plant   212 -GLFLLPDFVTVAEEQQLLAAV--DAR--HWIG-LAKRRVQHYGYEFCYGTRNVDTKKRLGE-LP 269

  Fly   200 SACDILWPRLNSFASTWDWSSP---DQLTVNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMD 261
            |....:..|:..|.:..:.|:.   ||||||||..|.|:.||:||||||.|.|.||||....:|:
plant   270 SFVSPILERIYLFPNFDNGSASLNLDQLTVNEYPSGVGLSPHIDTHSAFEDCIFSLSLAGPCIME 334

  Fly   262 FRR----------------GDD---QVQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGG 307
            |||                ||.   :..:.||.||:|::||||||.|.|.|....||.|...   
plant   335 FRRYSVSTWKASTTDAEKSGDSSCIKKALYLPPRSMLLLSGEARYAWNHYIPHHKIDKVKDK--- 396

  Fly   308 LTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQ 341
             ..:...:|.|.|.|::|..||.|.||..||:||
plant   397 -VIRRSSRRVSFTLRKVRNHPCSCKYPQYCDSQQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 19/96 (20%)
2OG-FeII_Oxy 136..322 CDD:304390 84/207 (41%)
Methyltransf_11 400..490 CDD:285453
TRM9NP_174442.2 RRM_SF 111..183 CDD:240668 18/88 (20%)
2OG-FeII_Oxy 212..410 CDD:304390 84/207 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2421
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D996085at2759
OrthoFinder 1 1.000 - - FOG0001370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100549
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X865
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.