DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and AT1G11780

DIOPT Version :10

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_172643.1 Gene:AT1G11780 / 837723 AraportID:AT1G11780 Length:345 Species:Arabidopsis thaliana


Alignment Length:183 Identity:43/183 - (23%)
Similarity:68/183 - (37%) Gaps:48/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 IIADFVTEE-----EESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSI 198
            ::.|.:|..     ||..:.:|.....::...:..|:.......|.:|.:...|.|.|.| ..:|
plant   139 LVQDDLTNNKWKFYEEVDIEKATRSSCKSVSASVLLRKLRWSTLGLQFDWSKRNYDVSLP-HNNI 202

  Fly   199 PSA-CD-------ILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVDTHSA-FLDPILSLSL 254
            |.| |.       |..|....|       .|:...||.:..|..:..|:|...| :..||:|:||
plant   203 PDALCQLAKTHAAIAMPDGEEF-------RPEGAIVNYFGIGDTLGGHLDDMEADWSKPIVSMSL 260

  Fly   255 QSDVV--------------MDFRRGDDQVQVRLPRRSLLIMSGEARYDWTHGI 293
            ....:              |..|.||           :::|:|||| :..|||
plant   261 GCKAIFLLGGKSKDDPPHAMYLRSGD-----------VVLMAGEAR-ECFHGI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:409865
2OG-FeII_Oxy 136..322 CDD:473886 43/183 (23%)
UbiE 368..498 CDD:441828
AT1G11780NP_172643.1 2OG-FeII_Oxy_2 86..342 CDD:433285 43/183 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.