DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and AT4G02485

DIOPT Version :10

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_567239.1 Gene:AT4G02485 / 827953 AraportID:AT4G02485 Length:226 Species:Arabidopsis thaliana


Alignment Length:211 Identity:63/211 - (29%)
Similarity:93/211 - (44%) Gaps:55/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GLHIIADFVTEEEESTLLRAIGEDGRTSE--VTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSI 198
            ||.:..:|::...:|.||.||..:|...|  :..:::..::..:..|.         |..:.:::
plant    46 GLWLYRNFLSIAHQSHLLSAILNEGWFVEESINQAMRFGDLPSWATEL---------SDLIRETL 101

  Fly   199 PS------ACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVDTHSAFLDPILSLSLQSD 257
            .|      :.|:|| |...|         |||.||.|:||.||..|||. ..|.|.|..:||:|.
plant   102 ESVDLPVLSADLLW-REPLF---------DQLIVNLYQPGEGICAHVDL-LRFEDGIAIVSLESP 155

  Fly   258 VVMDFRRGD----DQVQVRLPRRSLLIMSGEARYDWTHGIRPK----------HIDVVPSASGGL 308
            .||.|...:    :.|.|.|...||::|||||||.|.|.|..|          .||         
plant   156 CVMRFSPAEKNEYEAVDVLLNPGSLILMSGEARYRWKHEINRKQNGFQLWEGEEID--------- 211

  Fly   309 TTQARGKRTSLTFRRL 324
                :.:|.|:|.|:|
plant   212 ----QKRRISITLRKL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:409865
2OG-FeII_Oxy 136..322 CDD:473886 61/207 (29%)
UbiE 368..498 CDD:441828
AT4G02485NP_567239.1 2OG-FeII_Oxy 46..221 CDD:473886 61/207 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.