DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and AT3G14160

DIOPT Version :10

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_566479.5 Gene:AT3G14160 / 820633 AraportID:AT3G14160 Length:455 Species:Arabidopsis thaliana


Alignment Length:113 Identity:30/113 - (26%)
Similarity:50/113 - (44%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PDQLTVNEYEPGHGIPPHVDTHSAFLD-----PILSLSL--QSDVVMDFRRGDDQVQ-VRLPRRS 277
            ||...||.|.....:..|.|...:...     |::|.|:  .::.:...:|.:|:.: :.|....
plant   346 PDICIVNFYSSTGRLGLHQDKDESENSIRKGLPVVSFSIGDSAEFLYGDQRDEDKAETLTLESGD 410

  Fly   278 LLIMSGEARYDWTHGIRPKHIDVVPSASGGL--TTQARGKRTSLTFRR 323
            :|:..|.:|..: ||:|....|..|.|   |  .|..|..|.:||||:
plant   411 VLLFGGRSRKVF-HGVRSIRKDTAPKA---LLQETSLRPGRLNLTFRQ 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:409865
2OG-FeII_Oxy 136..322 CDD:473886 28/110 (25%)
UbiE 368..498 CDD:441828
AT3G14160NP_566479.5 2OG-FeII_Oxy_2 236..453 CDD:433285 28/110 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.