DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and AT3G14140

DIOPT Version :10

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_188030.2 Gene:AT3G14140 / 820631 AraportID:AT3G14140 Length:473 Species:Arabidopsis thaliana


Alignment Length:223 Identity:46/223 - (20%)
Similarity:71/223 - (31%) Gaps:95/223 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETQQKVNKAKKADKKQRRCLAIIKSDCEVSPSAEPTPYLAVLNVGLSNGLTEECLLTEAAATGGK 69
            |..|.|.||.|..|      :::.::...:...:..|.|          |.:.|::....:||..
plant   317 EFSQLVEKAIKESK------SLVATNSNETKGGDEIPLL----------LPDICVVNFYTSTGKL 365

  Fly    70 VIQVVMLPGKSYCFFICASLEDSQLIYEGMHNISTIGQQGAVAYLSYIRQLPALAGKSEWNKPLP 134
            .:..|.:..|:...|         |.|:|             .||:        ..|.|..|.|.
plant   366 GLHQVSVYDKTSFDF---------LKYKG-------------GYLN--------TDKGESKKSLR 400

  Fly   135 RGLHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYG-TNNVDPSKPL---- 194
            :||.|::            .:||:..                   ||||| ..:||.:..|    
plant   401 KGLPIVS------------FSIGDSA-------------------EFLYGDQKDVDKADTLILES 434

  Fly   195 -------EQS------IPSACDILWPRL 209
                   |:|      :.|...||.|||
plant   435 GDVLIFGERSRNVFHGVRSIRKILPPRL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:409865 14/78 (18%)
2OG-FeII_Oxy 136..322 CDD:473886 21/92 (23%)
UbiE 368..498 CDD:441828
AT3G14140NP_188030.2 2OG-FeII_Oxy_2 241..462 CDD:433285 44/221 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.