DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and ndufaf5

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001076363.1 Gene:ndufaf5 / 794020 ZFINID:ZDB-GENE-070410-110 Length:321 Species:Danio rerio


Alignment Length:150 Identity:31/150 - (20%)
Similarity:59/150 - (39%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 IADHFSETRHTPWPQVSEFLDSFEPQSVVLDIG--CGNGKY--LSCNPLLLSVGCDRAQGLLAVG 431
            :.|...:.|...|  .|..|||.:...:..::|  ..:..|  ....||.|.|||.|:.....:.
Zfish    26 VFDRSMKRRQKDW--ASSLLDSSKYDYLREEVGSRVADRVYDVARTFPLALDVGCGRSHIAEHLS 88

  Fly   432 RRKGQNVFRCD-----------------CLV-----VPVRSSSIDGCISIAVIHHLATKERRLAA 474
            :...:.:|..|                 |::     :|.:.::.|..:|...:|.:....   .|
Zfish    89 KEVVERLFLTDISSSSLRNRKTSDIPAQCVMADEEFLPFKENTFDLVLSSLSMHWINDLP---GA 150

  Fly   475 LQEMARVLRPGGRALVYVWA 494
            |:::.:||:|.|   |::.|
Zfish   151 LRQIHQVLKPDG---VFIGA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 22/115 (19%)
ndufaf5NP_001076363.1 BioC 67..290 CDD:273953 21/106 (20%)
Methyltransf_11 74..165 CDD:285453 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.