DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and alkbh1

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_012824070.2 Gene:alkbh1 / 779848 XenbaseID:XB-GENE-6453434 Length:398 Species:Xenopus tropicalis


Alignment Length:261 Identity:54/261 - (20%)
Similarity:96/261 - (36%) Gaps:81/261 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 VTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKH---------FGFEFLYGTN--NVDPSKP---- 193
            :|.|:.|.|..:..|..|:.    |.:.||.|.         .|:.:.:.|.  |.|...|    
 Frog   136 MTLEQTSDLWGSSQEQLRSK----SAEKRNKKSVLEKLRWVTLGYHYNWDTKTYNSDLLSPFPLD 196

  Fly   194 ---LEQSIPSACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVDTHSAFLD---PILSL 252
               |.:.:.:||.     .::|       .|:...:|.|.....:..|||  .:.||   |:||.
 Frog   197 LAELSRCVSAACG-----FHNF-------KPEAGILNYYHLDSSLGIHVD--ESELDHQSPLLSF 247

  Fly   253 SL-QSDVVM--DFRRGDDQVQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGGL------ 308
            |. ||.:.:  ...|......:.:....:::|||::|..: |.: |:   ::|...|.:      
 Frog   248 SFGQSCIFLLGGLNREHMPTPMMMHSGDIMVMSGQSRLLY-HAV-PR---ILPFPGGDMLPPCLS 307

  Fly   309 ---TTQA---------------------RGKRTSLTFRR-LRKGPCDCSYPALCDTQQTKVPQEL 348
               .|:.                     |..|.::|.|: |::|   ||:|.:.:..|.......
 Frog   308 VPPATETSDPPLIEPCSTLDWEVCAQYLRRSRINMTVRQVLQEG---CSFPQVENLSQLTEADSY 369

  Fly   349 H 349
            |
 Frog   370 H 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 46/231 (20%)
Methyltransf_11 400..490 CDD:285453
alkbh1XP_012824070.2 2OG-FeII_Oxy 120..290 CDD:419693 39/172 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.