DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Alkbh7

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001102854.1 Gene:Alkbh7 / 679944 RGDID:1598126 Length:221 Species:Rattus norvegicus


Alignment Length:194 Identity:53/194 - (27%)
Similarity:83/194 - (42%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 FVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSIPS-ACDILW 206
            |:::|||.||         |.|:...|:.|.     :|:.:..:.:...:..|:|..| |...:.
  Rat    39 FLSQEEEDTL---------TRELEPQLRRRR-----YEYDHWDSAIHGFRETEKSCWSDASQAIL 89

  Fly   207 PRLNSFASTWDWSSPDQ-----LTVNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMDF---R 263
            .|:.:.|     ..|||     :.|.:.|....|.||||:.......|..|||.|..||..   :
  Rat    90 QRVRAAA-----FGPDQTLLSLVHVLDLEHRGYIKPHVDSVKFCGSTIAGLSLLSPSVMKLVHTQ 149

  Fly   264 RGDDQVQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRLRKG 327
            ..:..:::.|...||.|:.|.||||::|.|....     .:..|.....||:|.|:..|.|.:|
  Rat   150 EPEQWLELLLEPGSLYILRGSARYDFSHEILRDE-----ESFFGAHRVPRGRRISVICRSLPEG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 50/187 (27%)
Methyltransf_11 400..490 CDD:285453
Alkbh7NP_001102854.1 2OG-FeII_Oxy 33..200 CDD:419693 49/184 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.