DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Carm1

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_067506.2 Gene:Carm1 / 59035 MGIID:1913208 Length:608 Species:Mus musculus


Alignment Length:151 Identity:33/151 - (21%)
Similarity:55/151 - (36%) Gaps:49/151 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 EQQNVHEVYDKIADHFSE--TRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLSVGCD 422
            :|||:.:.|.:...:...  ..||      :|.|     .:|||:|||:|        :||....
Mouse   159 QQQNMMQDYVRTGTYQRAILQNHT------DFKD-----KIVLDVGCGSG--------ILSFFAA 204

  Fly   423 RAQGLLAVGRRK-----------------GQNVFRCDCLVVP--VRSSSIDGCISIAV---IHHL 465
            :|      |.||                 ..|......:|:|  |...|:...:.|.:   :.::
Mouse   205 QA------GARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYM 263

  Fly   466 ATKERRLAALQEMARVLRPGG 486
            ...||.|.:.....:.|:|.|
Mouse   264 LFNERMLESYLHAKKYLKPSG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 24/109 (22%)
Carm1NP_067506.2 CARM1 35..139 CDD:402914
AdoMet_MTases 189..284 CDD:100107 24/108 (22%)
Transactivation domain 500..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.