DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and si:dkey-190g11.3

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001107079.1 Gene:si:dkey-190g11.3 / 567059 ZFINID:ZDB-GENE-081104-341 Length:215 Species:Danio rerio


Alignment Length:258 Identity:56/258 - (21%)
Similarity:84/258 - (32%) Gaps:91/258 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CEVSPSAEPTPYLAVLNVGLSNGL--------------TEECLLTEAAATGGKVIQVVM--LPGK 79
            ||:|...|..|.:...:.....|:              ...||......:.....|.||  |.|:
Zfish    14 CELSRHTEEKPLVTAASGAFLAGVYGLWTLFALPGFRKVPICLKVPYLPSSRTQTQNVMKLLRGR 78

  Fly    80 SYCFFICASLEDSQLIY----EGMH----NISTIGQQGAVAYLSYIRQLPALAGKSEWNKPLPRG 136
            :.|.....| .|.:|::    :|.|    .|::|       ...|.|.      ||.| |.:|..
Zfish    79 AGCLADLGS-GDGRLVFAATAKGFHCTGFEINSI-------LTGYARV------KSNW-KGIPSS 128

  Fly   137 LHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHF---GFEFLYGTNNVDPSKPLEQSI 198
               .|.||.::...|.|.               |:.||..|   |...:.|       :.||:.:
Zfish   129 ---TASFVNQDFWKTDLS---------------KYNNVTVFLAPGVMEVLG-------RKLEKEL 168

  Fly   199 PS-----ACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVDTHSAFLDPILSLSLQS 256
            |.     ||...:|         ||:.    |..|   |.|:.   .|.:..::.|..||.|:
Zfish   169 PDEARVIACRFPFP---------DWTP----TATE---GEGLD---QTWAYDMNVIRKLSTQA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 18/102 (18%)
2OG-FeII_Oxy 136..322 CDD:304390 28/129 (22%)
Methyltransf_11 400..490 CDD:285453
si:dkey-190g11.3NP_001107079.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.