DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17807 and PRMT8

DIOPT Version :9

Sequence 1:	NP_611690.2	Gene:	CG17807 / 37585	FlyBaseID:	FBgn0034748	Length:	615	Species:	Drosophila melanogaster
Sequence 2:	NP_062828.3	Gene:	PRMT8 / 56341	HGNCID:	5188	Length:	394	Species:	Homo sapiens

Alignment Length:	134	Identity:	29/134 - (21%)
Similarity:	52/134 - (38%)	Gaps:	49/134 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   398 VVLDIGCGNGKYLSCNPLLLSVGCDRAQGLLAVGRRKGQNVFRCDCLVVP------VRSSSIDGC 456
            ||||:|.|.|        :||:...:|      |.:|   ||..:|..:.      ::::.:|..
Human   114 VVLDVGSGTG--------ILSMFAAKA------GAKK---VFGIECSSISDYSEKIIKANHLDNI 161

  Fly   457 ISI--AVIHHLATKERRLAAL-----------QEMARV--------LRPGG-----RALVYVWAK 495
            |:|  ..:..:.....::..:           :.|...        |:|||     ||.:||.|.
Human   162 ITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAI 226

  Fly   496 DQRK 499
            :.|:
Human   227 EDRQ 230

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17807	NP_611690.2	RRM_ALKBH8	40..119	CDD:240877
		2OG-FeII_Oxy	136..322	CDD:304390
		Methyltransf_11	400..490	CDD:285453	23/121 (19%)
PRMT8	NP_062828.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	16..40
		SH3-binding 1. /evidence=ECO:0000269\|PubMed:17925405	29..42
		SH3-binding 2. /evidence=ECO:0000269\|PubMed:17925405	53..58
		AdoMet_MTases	115..215	CDD:100107	22/116 (19%)
		S-adenosyl-L-methionine binding. /evidence=ECO:0000305\|PubMed:26529540, ECO:0000305\|PubMed:26876602, ECO:0007744\|PDB:4X41, ECO:0007744\|PDB:5DST	119..122		1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900