DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and ALKBH5

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_060228.3 Gene:ALKBH5 / 54890 HGNCID:25996 Length:394 Species:Homo sapiens


Alignment Length:223 Identity:55/223 - (24%)
Similarity:85/223 - (38%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 VNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMDF---------RRGDDQVQVRLPRRSLLIM 281
            :|:|:||..|..|||....|..||:|:|..||..:.|         |..:..:.:.:.|.|:.::
Human   192 INDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVL 256

  Fly   282 SGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTK--V 344
            ||.|..:.||.|||:.|              :.:|..:..|:.|     ...|.|    :||  .
Human   257 SGYAADEITHCIRPQDI--------------KERRAVIILRKTR-----LDAPRL----ETKSLS 298

  Fly   345 PQELHASLAAQAIT-------LEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDI 402
            ...|..|.|:..::       |:.:..|...|..|.|        .|::.|.......:||:|..
Human   299 SSVLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAH--------RPRILEMDKEENRRSVLLPT 355

  Fly   403 GCGNGKYLSCN----PLLLSVGCDRAQG 426
            ....|.:.|.|    ....|..|..|.|
Human   356 HRRRGSFSSENYWRKSYESSEDCSEAAG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 29/104 (28%)
Methyltransf_11 400..490 CDD:285453 8/31 (26%)
ALKBH5NP_060228.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..83
2OG-FeII_Oxy <136..270 CDD:389772 25/77 (32%)
Alpha-ketoglutarate binding. /evidence=ECO:0000269|PubMed:24778178 193..195 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..394 20/93 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.