DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and PRMT7

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_011521414.1 Gene:PRMT7 / 54496 HGNCID:25557 Length:714 Species:Homo sapiens


Alignment Length:362 Identity:75/362 - (20%)
Similarity:114/362 - (31%) Gaps:136/362 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CLAIIKSDCEV-SPSAEPTPYLAVLNVGLSNGLTEECLLTEAAATGGKVIQVVMLP-GKSYC--F 83
            |.||     || .|.|:     |.:.:...||.:::..:....:|     :|.:.| |...|  .
Human    90 CYAI-----EVFKPMAD-----AAVKIVEKNGFSDKIKVINKHST-----EVTVGPEGDMPCRAN 139

  Fly    84 FICASLEDSQLI-------YEGMH------NISTIGQQGAVAYLSYIRQLPALAGKSEWNKPLPR 135
            .:...|.|::||       ||..|      |...:..:..|     ..||........|||..| 
Human   140 ILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATV-----YAQLVESGRMWSWNKLFP- 198

  Fly   136 GLHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQ--SI 198
             :|:                     :||                   .|...:.|...:|.  ..
Human   199 -IHV---------------------QTS-------------------LGEQVIVPPVDVESCPGA 222

  Fly   199 PSACDILWPRLNSFASTWDWSSPDQLTV-NEYEP------GHGIPPHVDTHSAFLDPILSLSLQS 256
            ||.|||   :||..       ||...|| ::..|      ...:......||...:|:.|...|.
Human   223 PSVCDI---QLNQV-------SPADFTVLSDVLPMFSIDFSKQVSSSAACHSRRFEPLTSGRAQV 277

  Fly   257 -----DVVMD------------FRRGD-DQVQVR---------LPRRSLLIMSGEARYDWTHGIR 294
                 |:.||            :...| :::|.|         ||:.. .::.|.|.|...|   
Human   278 VLSWWDIEMDPEGKIKCTMAPFWAHSDPEEMQWRDHWMQCVYFLPQEE-PVVQGSALYLVAH--- 338

  Fly   295 PKHIDVVPSASGGLTTQARGKRTSLTFRRLRKGPCDC 331
              |.|.....|...|:..:.:|.    |::|. .|||
Human   339 --HDDYCVWYSLQRTSPEKNERV----RQMRP-VCDC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 17/94 (18%)
2OG-FeII_Oxy 136..322 CDD:304390 40/221 (18%)
Methyltransf_11 400..490 CDD:285453
PRMT7XP_011521414.1 AdoMet_MTases 37..>186 CDD:302624 26/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.