DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and fid

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_651453.3 Gene:fid / 43148 FlyBaseID:FBgn0259146 Length:1391 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:129/294 - (43%) Gaps:77/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 VVPSASGGLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTKVPQELH-----ASLAAQAITL 359
            :.|:|...|||...|          ..|......|....|:....||.:.     :..:.::..|
  Fly    75 ISPTAPSTLTTGGAG----------GAGAGGTISPVSEATKTAPPPQPVEEKPSSSDASGRSAAL 129

  Fly   360 EQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLS-CNPLLLSVGCDR 423
            |:..||:||    :|..|......|:::.||...:|.|||.|:|||:|:||: |||.:.::|.:|
  Fly   130 ERAYVHDVY----EHCEEPTGPVRPRMAHFLSGLDPGSVVCDVGCGSGRYLTQCNPAICTIGVER 190

  Fly   424 AQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVLRPGGRA 488
            ...|..|...||..|..||.|.:|.|..|.|..:|:||:||.||.|||:.||:|:||:||.|||.
  Fly   191 CYRLSKVAHEKGGEVALCDNLELPFRDDSFDAVLSLAVVHHFATTERRVQALRELARILRIGGRV 255

  Fly   489 LVYVWAKDQRKNDKKSTYLRQNKAVNKERTTEQQQRQKQHQELEQQLSNNNPLPVHTNRTEFQQQ 553
            ::.|||.:||                             |:                   .|:.|
  Fly   256 VITVWALEQR-----------------------------HR-------------------RFESQ 272

  Fly   554 DVLVPWK---------TKDEQKTTYLRYYHVFEE 578
            |||:||:         :.:|....:...||.:.|
  Fly   273 DVLIPWQPPKNRNYSYSDEEDDDNFQPPYHAYTE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 6/21 (29%)
Methyltransf_11 400..490 CDD:285453 44/90 (49%)
fidNP_651453.3 Methyltransf_11 167..257 CDD:285453 44/89 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455375
Domainoid 1 1.000 76 1.000 Domainoid score I2451
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1867
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D43353at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100549
Panther 1 1.100 - - P PTHR13069
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1711
SonicParanoid 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.