DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and CG14130

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster


Alignment Length:250 Identity:62/250 - (24%)
Similarity:90/250 - (36%) Gaps:75/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LPALAGKSEW----NKPLPRGLHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHF--- 177
            |.|..||  |    .|...:.:.||.||::|.||..|                  |..::.:   
  Fly    31 LTAYFGK--WPETEQKEFRQHMRIITDFISEPEEQQL------------------HEEIEPYMSR 75

  Fly   178 -GFEFLYGTNNVDPSKPLEQS--IPSACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHV 239
             .:||.:..:.:...:..|:.  .|...:|| .|:...|  :|.:....:.:.:..|...|.|||
  Fly    76 LRYEFDHWDDAIHGFRETERKKWFPKNREIL-ERVRQVA--FDGAVMPYVHILDLAPDGVIKPHV 137

  Fly   240 DTHSAFLDPILSLSLQSDVVMDFRRGDDQ------------------------------------ 268
            |:.....:.|..:||.||.||...|.|:|                                    
  Fly   138 DSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQPEASLKNNF 202

  Fly   269 -VQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFR 322
             ..:.||||||.|||..|||.:||.|..|...   ...|.|..:.|  |.|:..|
  Fly   203 YADILLPRRSLYIMSHTARYKFTHEILAKEHS---QFQGALVPRTR--RISIICR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 55/228 (24%)
Methyltransf_11 400..490 CDD:285453
CG14130NP_648511.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.