Sequence 1: | NP_611690.2 | Gene: | CG17807 / 37585 | FlyBaseID: | FBgn0034748 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648511.2 | Gene: | CG14130 / 39335 | FlyBaseID: | FBgn0036210 | Length: | 255 | Species: | Drosophila melanogaster |
Alignment Length: | 250 | Identity: | 62/250 - (24%) |
---|---|---|---|
Similarity: | 90/250 - (36%) | Gaps: | 75/250 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 LPALAGKSEW----NKPLPRGLHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHF--- 177
Fly 178 -GFEFLYGTNNVDPSKPLEQS--IPSACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHV 239
Fly 240 DTHSAFLDPILSLSLQSDVVMDFRRGDDQ------------------------------------ 268
Fly 269 -VQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFR 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17807 | NP_611690.2 | RRM_ALKBH8 | 40..119 | CDD:240877 | |
2OG-FeII_Oxy | 136..322 | CDD:304390 | 55/228 (24%) | ||
Methyltransf_11 | 400..490 | CDD:285453 | |||
CG14130 | NP_648511.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3145 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |