DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17807 and Mettl7a2

DIOPT Version :9

Sequence 1:	NP_611690.2	Gene:	CG17807 / 37585	FlyBaseID:	FBgn0034748	Length:	615	Species:	Drosophila melanogaster
Sequence 2:	NP_955771.2	Gene:	Mettl7a2 / 393082	MGIID:	3026615	Length:	244	Species:	Mus musculus

Alignment Length:	129	Identity:	33/129 - (25%)
Similarity:	57/129 - (44%)	Gaps:	40/129 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   399 VLDIGCGNG---KY------LSC---NP-----LLLSVGCDR----AQGLLAVGRRKGQNVFRCD 442
            :|::|||.|   |:      ::|   ||     |..||..:|    .:.::|.|....|
Mouse    74 LLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLFKSVAENRQLQFERFVVAAGEDMHQ------ 132

  Fly   443 CLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVLRPGGRALVYVWAKDQRKNDKKSTY 506
                 |...|:|..:...|:..:..:|:   .|:|:.|||:||| |..::    ....|::||:
Mouse   133 -----VTDGSVDVVVCTLVLCSVKNQEK---ILREVCRVLKPGG-AFYFI----DHVADERSTW 183

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17807	NP_611690.2	RRM_ALKBH8	40..119	CDD:240877
		2OG-FeII_Oxy	136..322	CDD:304390
		Methyltransf_11	400..490	CDD:285453	30/110 (27%)
Mettl7a2	NP_955771.2	SmtA	70..>200	CDD:223574	33/129 (26%)
Mettl7a2	NP_955771.2	Methyltransf_11	75..172	CDD:285453	30/111 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900