DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Prmt7

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:278 Identity:56/278 - (20%)
Similarity:82/278 - (29%) Gaps:117/278 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LLTEAAATGGKVIQVVMLPGKSYCFFICASLEDSQLIYEGMHNISTIGQQGAVAYLSYIRQ---- 119
            |||.|...|.||..::..|     ||..:.|.        .||:          |..|:|.    
  Rat   461 LLTSADLEGKKVSLLLGEP-----FFTTSLLP--------WHNL----------YFWYVRTSVDQ 502

  Fly   120 --------LPALAG--------KSEWNKPLPRG------LHIIADFV---------TEEEESTL- 152
                    :|..|.        :..|....|.|      :||:.|.:         .|.|...| 
  Rat   503 HLAPGAVVMPQAASLHAVIVEFRDLWRIRSPCGDCEGFDVHIMDDMIKHSLDFRESREAEPQPLW 567

  Fly   153 ---LRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSIPSACDILWPRLNSFAS 214
               .|::.|.            |.:..|.|:      ...|.:|::..  ...::..|..:..|.
  Rat   568 EYPCRSLSEP------------RQILTFDFQ------QPIPQQPMQSR--GVMELRRPGKSHGAV 612

  Fly   215 TW-DWSSPDQLTVNEYEPGHGI------------PPH----VDTHSAFLDPILSLS--------- 253
            .| ::......||:.     |:            .||    |...||.|||...|.         
  Rat   613 LWMEYQLTPDSTVST-----GLMNPAEDKGDCCWNPHCKQAVYFLSATLDPSAPLDGPQSVSYAV 672

  Fly   254 ----LQSDVVMDFRRGDD 267
                |..|:.|:||..||
  Rat   673 EFHPLTGDITMEFRLADD 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 15/59 (25%)
2OG-FeII_Oxy 136..322 CDD:304390 36/181 (20%)
Methyltransf_11 400..490 CDD:285453
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.