Sequence 1: | NP_611690.2 | Gene: | CG17807 / 37585 | FlyBaseID: | FBgn0034748 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014175.1 | Gene: | Prmt7 / 361402 | RGDID: | 1304869 | Length: | 693 | Species: | Rattus norvegicus |
Alignment Length: | 278 | Identity: | 56/278 - (20%) |
---|---|---|---|
Similarity: | 82/278 - (29%) | Gaps: | 117/278 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 LLTEAAATGGKVIQVVMLPGKSYCFFICASLEDSQLIYEGMHNISTIGQQGAVAYLSYIRQ---- 119
Fly 120 --------LPALAG--------KSEWNKPLPRG------LHIIADFV---------TEEEESTL- 152
Fly 153 ---LRAIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSIPSACDILWPRLNSFAS 214
Fly 215 TW-DWSSPDQLTVNEYEPGHGI------------PPH----VDTHSAFLDPILSLS--------- 253
Fly 254 ----LQSDVVMDFRRGDD 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17807 | NP_611690.2 | RRM_ALKBH8 | 40..119 | CDD:240877 | 15/59 (25%) |
2OG-FeII_Oxy | 136..322 | CDD:304390 | 36/181 (20%) | ||
Methyltransf_11 | 400..490 | CDD:285453 | |||
Prmt7 | NP_001014175.1 | AdoMet_MTases | 37..>188 | CDD:302624 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |