DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and CG6144

DIOPT Version :10

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_609414.3 Gene:CG6144 / 34443 FlyBaseID:FBgn0032259 Length:228 Species:Drosophila melanogaster


Alignment Length:222 Identity:57/222 - (25%)
Similarity:87/222 - (39%) Gaps:43/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PRGLHIIADFVTEEEESTLLRAIGEDGRTSEV--TGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQ 196
            |..:..|.:|:|.|||..:|..|   .||.:.  |..|..|.|.:.|..        .|:..:.:
  Fly    12 PPTVMYIPNFITSEEEQRILSHI---ERTPKPRWTQLLNRRLVNYGGVP--------HPNGMIAE 65

  Fly   197 SIPSACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVDTHSAFLDPILS-LSLQSDVVM 260
            .||........::|:. ..::..:.:.:.||||.||.||.||.|  .....||:| :|..:..|:
  Fly    66 EIPEWLQTYVDKVNNL-GVFESQNANHVLVNEYLPGQGILPHTD--GPLFHPIISTISTGAHTVL 127

  Fly   261 DFRRGDDQV---------------QVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASG---- 306
            :|.:.:|..               ::.|..|||||:......|:.|.|.....||:.....    
  Fly   128 EFVKREDTTTETEAGDQTTREVLFKLLLEPRSLLILKDTLYTDYLHAISETSEDVLCDRISNYDL 192

  Fly   307 -------GLTTQARGKRTSLTFRRLRK 326
                   |.....|..|.|||.|.:.|
  Fly   193 CENTYKIGDHLVRRSPRISLTIRNVPK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:409865
2OG-FeII_Oxy 136..322 CDD:473886 54/214 (25%)
UbiE 368..498 CDD:441828
CG6144NP_609414.3 2OG-FeII_Oxy 15..215 CDD:473886 54/213 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.