DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Trmt9b

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001100784.1 Gene:Trmt9b / 306504 RGDID:1304810 Length:446 Species:Rattus norvegicus


Alignment Length:438 Identity:105/438 - (23%)
Similarity:156/438 - (35%) Gaps:183/438 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 QAITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLSV 419
            :|:.||:|:||:||:..|.:||:.::..||:|.:||...:|.|::.|||||.||||..|..:.::
  Rat     4 EAVQLEKQHVHKVYESTAPYFSDLQNKAWPRVRQFLQDQKPGSLIADIGCGTGKYLKVNSQVHTL 68

  Fly   420 GCDRAQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVLRP 484
            |||....|:.:.|.:|..|..||.|.:|.|....|..|||.||||.:||:||:.|::||||||.|
  Rat    69 GCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDAIISIGVIHHFSTKQRRIRAIKEMARVLAP 133

  Fly   485 GGRALVYVWAKDQRKN--DKKSTYLRQNKAVNKERTTEQQQ------------------------ 523
            ||:.::||||.:|:..  :|:...:..|:|:.....:|..|                        
  Rat   134 GGQLMIYVWAMEQKNRHFEKQDVLVPWNRALCSRLLSESHQSWGHSCEHPTSQGYQGPGSACSCA 198

  Fly   524 -----------------------------------------------------RQKQHQELEQQL 535
                                                                 |......|.:|:
  Rat   199 VCFKGRCDSKRSHSMDYGPAVARTCCEAISKEGQQENGLYSNFGKSFRSWFFSRSLDESTLRKQI 263

  Fly   536 SNNNPLPVH--TNRTEFQQQD--------VLVPWKTK----DE---------------------- 564
            ....|:.:.  .|.|...|..        ...|:.||    ||                      
  Rat   264 ERVRPMKIEGWANSTVSHQPSRYPSVDLHAQEPFSTKRPNLDEVFVDASSQRHVGCLGVPSTSDN 328

  Fly   565 ----------------------------------------------------------------- 564
                                                                             
  Rat   329 FIGHKGGESRRKEGGNFLDTTDTGNSVAARNGGDRSARKILRRVSAFDSTDSTSEDPSFVEGQQD 393

  Fly   565 --QKTTYLRYYHVFEEQELENLVSQ-VHEVQLIKSYYDQGNHCAIFEK 609
              ....::||||||.|.||.:|:.: |.|:|::.|..|.||.|.|.||
  Rat   394 GPDSKAFMRYYHVFREGELSSLLQECVSELQVLSSGNDHGNWCIIAEK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 44/89 (49%)
Trmt9bNP_001100784.1 Methyltransf_11 50..139 CDD:285453 44/88 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434082at33208
OrthoFinder 1 1.000 - - FOG0001370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100549
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X865
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.