DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Alkbh2

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_006249560.1 Gene:Alkbh2 / 304578 RGDID:1306377 Length:287 Species:Rattus norvegicus


Alignment Length:297 Identity:62/297 - (20%)
Similarity:98/297 - (32%) Gaps:109/297 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QQGAVAYLSY----IRQLPALAGKSEWNKPLPRGLHIIAD------FVTEEEESTLLRAIGEDGR 161
            :.|.|..|:|    ..:.|..:|...|          :|.      |:...:...:..|..|...
  Rat    16 EHGCVPVLAYPAGRRTEAPCFSGTRLW----------LAGGGGMDRFLVRPDRGDIQGAAEEPAP 70

  Fly   162 TSEVTGSLKHRNVKHFGFEFLYGTNNVDPS------------KPLEQSIPSACDIL--------W 206
            |.|.:|.::....:||..|.|    |.|.:            :.|||.:......|        |
  Rat    71 TGEASGDMQSPGWQHFRAEGL----NCDYTVLFRKAEADQIFRELEQEVEYFTGALAKVQVFGKW 131

  Fly   207 ---PR----LNSFASTWDWS----SP-----------DQ-----------LTVNEYEPG--HGIP 236
               ||    ......|:.:|    :|           ||           :.||.|:.|  | |.
  Rat   132 HSVPRKQATYGDAGLTYTFSGLTLTPKPWIPVLERVRDQVCRVTGQTFNFVLVNRYKDGCDH-IG 195

  Fly   237 PHVDTHSAFL--DPILSLSLQS--DVVMDFRRGDDQ----------VQVRLPRRSLLIMSGEARY 287
            .|.|......  .||.|:|..:  |::  ||..|.:          |:::|...|||:|:.....
  Rat   196 EHRDDERELAPGSPIASVSFGACRDIL--FRHKDSRGKRPRRAVEVVRLQLAHGSLLMMNHPTNT 258

  Fly   288 DWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRL 324
            .|.|.:..:...:.|             |.:||||::
  Rat   259 HWYHSLPIRKRVLAP-------------RINLTFRKI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 4/15 (27%)
2OG-FeII_Oxy 136..322 CDD:304390 53/260 (20%)
Methyltransf_11 400..490 CDD:285453
Alkbh2XP_006249560.1 2OG-FeII_Oxy_2 98..280 CDD:290266 40/197 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.