Sequence 1: | NP_611690.2 | Gene: | CG17807 / 37585 | FlyBaseID: | FBgn0034748 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001178572.1 | Gene: | Alkbh5 / 303193 | RGDID: | 1309496 | Length: | 395 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 51/206 - (24%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 VNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMDF---------RRGDDQVQVRLPRRSLLIM 281
Fly 282 SGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTK--V 344
Fly 345 PQELHASLAAQAIT-------LEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDI 402
Fly 403 GCGNGKYLSCN 413 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17807 | NP_611690.2 | RRM_ALKBH8 | 40..119 | CDD:240877 | |
2OG-FeII_Oxy | 136..322 | CDD:304390 | 29/104 (28%) | ||
Methyltransf_11 | 400..490 | CDD:285453 | 4/14 (29%) | ||
Alkbh5 | NP_001178572.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 47..83 | ||||
2OG-FeII_Oxy | <137..271 | CDD:419693 | 25/77 (32%) | ||
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q6P6C2 | 194..196 | 1/1 (100%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..395 | 18/82 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3145 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |