DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Alkbh5

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001178572.1 Gene:Alkbh5 / 303193 RGDID:1309496 Length:395 Species:Rattus norvegicus


Alignment Length:206 Identity:51/206 - (24%)
Similarity:81/206 - (39%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 VNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMDF---------RRGDDQVQVRLPRRSLLIM 281
            :|:|:||..|..|||....|..||:|:|..||..:.|         |..:..:.:.:.|.|:.::
  Rat   193 INDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVL 257

  Fly   282 SGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTK--V 344
            ||.|..:.||.|||:.|              :.:|..:..|:.|     ...|.|    :||  .
  Rat   258 SGYAADEITHCIRPQDI--------------KERRAVIILRKTR-----LDAPRL----ETKSLS 299

  Fly   345 PQELHASLAAQAIT-------LEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDI 402
            ...|..|.|:..::       |:.:..|...|..|.|        .|::.|.......:||:|..
  Rat   300 SSTLPPSYASDRLSGNTRDPALKPKRSHRKADPDAAH--------RPRILEMDKEENRRSVLLPT 356

  Fly   403 GCGNGKYLSCN 413
            ....|.:.|.|
  Rat   357 HRRRGSFSSEN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 29/104 (28%)
Methyltransf_11 400..490 CDD:285453 4/14 (29%)
Alkbh5NP_001178572.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..83
2OG-FeII_Oxy <137..271 CDD:419693 25/77 (32%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q6P6C2 194..196 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..395 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.