DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Alkbh5

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_766531.2 Gene:Alkbh5 / 268420 MGIID:2144489 Length:395 Species:Mus musculus


Alignment Length:359 Identity:75/359 - (20%)
Similarity:122/359 - (33%) Gaps:107/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EDSQLIYEGMHNISTIGQQGAVAYLSYIRQLPALAGKSEWNKPLPRGLHIIADFVTEEEESTLLR 154
            |:::.:..|:..|....|.......:.|.::.:.|.|..:|                  |.|:.|
Mouse    81 EEA
RKVKSGIRQIRLFSQDECSKIEARIDEVVSRAEKGLYN------------------EHTVDR 127

  Fly   155 AIGEDGRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSKPLEQSIPSACDILWPRLNSFASTWDW- 218
            |              ..||...||..:.||..       |::..|.. :.|:|. .......|| 
Mouse   128 A--------------PLRNKYFFGEGYTYGAQ-------LQKRGPGQ-ERLYPP-GDVDEIPDWV 169

  Fly   219 ----------------SSPDQLTVNEYEPGHGIPPHVDTHSAFLDPILSLSLQSDVVMDF----- 262
                            ...:...:|:|:||..|..|||....|..||:|:|..||..:.|     
Mouse   170 HQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQ 234

  Fly   263 ----RRGDDQVQVRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRR 323
                |..:..:.:.:.|.|:.::||.|..:.||.|||:.|              :.:|..:..|:
Mouse   235 FKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDI--------------KERRAVIILRK 285

  Fly   324 LRKGPCDCSYPALCDTQQTK--VPQELHASLAAQAIT-------LEQQNVHEVYDKIADHFSETR 379
            .|     ...|.|    :||  ....|..|.|:..::       |:.:..|...|..|.|     
Mouse   286 TR-----LDAPRL----ETKSLSSSTLPPSYASDRLSGNTRDPALKPKRSHRKADPDAAH----- 336

  Fly   380 HTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCN 413
               .|::.|.......:||:|......|.:.|.|
Mouse   337 ---RPRILEMDKEENRRSVLLPTHRRRGSFSSEN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 5/28 (18%)
2OG-FeII_Oxy 136..322 CDD:304390 45/211 (21%)
Methyltransf_11 400..490 CDD:285453 4/14 (29%)
Alkbh5NP_766531.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..83 1/1 (100%)
2OG-FeII_Oxy <137..271 CDD:328754 34/142 (24%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q6P6C2 194..196 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..395 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.