DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Alkbh2

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001346869.1 Gene:Alkbh2 / 231642 MGIID:2141032 Length:239 Species:Mus musculus


Alignment Length:244 Identity:49/244 - (20%)
Similarity:83/244 - (34%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PALAGKSEWNKPLPRGLHIIADFVT--------EEEESTLLRAIGEDGRTSEVTGSL-------- 169
            ||..|.:..:...|...|:.|:.::        :.|...:.|.:.::  ....||:|        
Mouse    20 PAPTGGASGDLKSPDWRHLRAEGLSCDYTVLFGKAEADKIFRELEQE--VEYFTGALAKVQVFGK 82

  Fly   170 ------KHRNVKHFGFEFLYGTNNVDPSKP----LEQSIPSACDILWPRLNSFASTWDWSSPDQL 224
                  |.......|..:.:....:.| ||    ||:.....|::.....|.            :
Mouse    83 WHSVPRKQATYGDAGLTYTFSGLTLTP-KPWVPVLERVRDRVCEVTGQTFNF------------V 134

  Fly   225 TVNEYEPG--HGIPPHVDTHSAFL--DPILSLSLQSDVVMDFRRGDDQ----------VQVRLPR 275
            .||.|:.|  | |..|.|......  .||.|:|..:.....||..|.:          |:::|..
Mouse   135 LVNRYKDGCDH-IGEHRDDERELAPGSPIASVSFGACRDFIFRHKDSRGKRPRRTVEVVRLQLAH 198

  Fly   276 RSLLIMSGEARYDWTHGIRPKHIDVVPSASGGLTTQARGKRTSLTFRRL 324
            .|||:|:......|.|.:..:...:.|             |.:||||::
Mouse   199 GSLLMMNPPTNTHWYHSLPIRKRVLAP-------------RVNLTFRKI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 43/225 (19%)
Methyltransf_11 400..490 CDD:285453
Alkbh2NP_001346869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 11..32 3/11 (27%)
2OG-FeII_Oxy_2 50..232 CDD:372627 41/210 (20%)
Substrate binding. /evidence=ECO:0000250 80..82 0/1 (0%)
Substrate binding. /evidence=ECO:0000250 100..102 0/1 (0%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250 137..139 1/1 (100%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250 226..232 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.