DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and C35D10.12

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_498018.1 Gene:C35D10.12 / 183240 WormBaseID:WBGene00016448 Length:365 Species:Caenorhabditis elegans


Alignment Length:364 Identity:92/364 - (25%)
Similarity:151/364 - (41%) Gaps:119/364 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 LEQQNVHEVYDKIADHFSETRHTP-----WPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLS 418
            :||:.||.:|.::|. :.:..|.|     ||:|.:|:|.....|::||:|||..||.|....:  
 Worm     8 VEQEYVHSIYSRLAT-YQQKEHKPSSPRIWPRVRQFVDQQSAGSIILDVGCGEAKYTSQKSHV-- 69

  Fly   419 VGCDRAQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVLR 483
            :|.|....:|:..::...::...|.:.:|:|..|:|..::::|||||||..||...|||.:|.||
 Worm    70 IGFDTCSEVLSSSKKDDIDLCLADAINIPIRDDSVDAILNVSVIHHLATTARRRQVLQECSRCLR 134

  Fly   484 PGGRALVYVWAKDQRKNDKKSTYLRQNKAV--NKERT--------------TEQQQR-------- 524
            .||:.|:|.||.:| .|.|   :..|:..|  |...|              |.::||        
 Worm   135 IGGQMLIYAWAFEQ-PNGK---FASQDILVPWNMHETAIGGRLPKVKFHLNTTKEQRVIAASIPV 195

  Fly   525 --------QKQHQ-ELEQQLSNNNPLPVHT----NRTEFQQQ----------------------- 553
                    ||... .|.:.:|..:.||..:    |...:..|                       
 Worm   196 NISDGSIPQKWFSGVLSKVVSLTDQLPYFSKRCPNSPAYSNQSTPTGSLSSPMVQKLPSAAPQFL 260

  Fly   554 ----------------------DVLVPWKTKDEQ----------------------KTTYLRYYH 574
                                  .:|||   .:||                      :.|:.|:||
 Worm   261 PTTNSLISGIKRWSPMLGRRLASLLVP---VEEQFGEELAQTIMRESITEAMATLREVTFYRFYH 322

  Fly   575 VFEEQELENLVSQVHEVQLIKSYYDQGNHCAIFEKLSNN 613
            ||::.||.:||..|..::::.:.::.||.|.|.||::.|
 Worm   323 VFKDGELADLVDSVESLKVVSATFEHGNWCVIAEKVAAN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 33/89 (37%)
C35D10.12NP_498018.1 Methyltransf_11 53..141 CDD:369777 33/89 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434082at33208
OrthoFinder 1 1.000 - - FOG0001370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100549
Panther 1 1.100 - - O PTHR13069
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1711
SonicParanoid 1 1.000 - - X865
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.