Sequence 1: | NP_611690.2 | Gene: | CG17807 / 37585 | FlyBaseID: | FBgn0034748 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504052.1 | Gene: | R08F11.4 / 178797 | WormBaseID: | WBGene00019968 | Length: | 354 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 69/203 - (33%) | Gaps: | 52/203 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 325 RKGPCDCSYPALCDTQQ-----TKVPQELHASLAAQAITLEQQNVHEVYDKIADHFSETRHTPWP 384
Fly 385 QVSEFLDSFEPQSV-VLDIGCGNGKYLSC----NPLLLSVGCDRAQGLLAVGRRKGQN------- 437
Fly 438 --VFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVLRPGGRALVYVWAKDQRKN 500
Fly 501 --DKKSTY 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17807 | NP_611690.2 | RRM_ALKBH8 | 40..119 | CDD:240877 | |
2OG-FeII_Oxy | 136..322 | CDD:304390 | |||
Methyltransf_11 | 400..490 | CDD:285453 | 24/102 (24%) | ||
R08F11.4 | NP_504052.1 | Methyltransf_31 | 165..>281 | CDD:316372 | 30/119 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |