DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and pmt-1

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_494991.1 Gene:pmt-1 / 173901 WormBaseID:WBGene00022781 Length:484 Species:Caenorhabditis elegans


Alignment Length:355 Identity:54/355 - (15%)
Similarity:111/355 - (31%) Gaps:142/355 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 ITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSV-----------VLDIGCGNGKYL 410
            :.:.:.|....:||.:|. .:|........:|.|:|.:...:           |:|||.|.|:: 
 Worm    26 VNVRRANFKSFWDKYSDK-PDTNSMMLNHSAEELESSDRADILASLPLLHNKDVVDIGAGIGRF- 88

  Fly   411 SCNPLLLSVGCDRAQGLLAVG-----RRKGQ---------NVFRCDCLVVPVRSSSIDGCISIAV 461
                  .:|..:.|:.:|:..     .:|.|         |....|.:.:.:.|:|:|...:..:
 Worm    89 ------TTVLAETARWVLSTDFIDSFIKKNQERNAHLGNINYQVGDAVGLKMESNSVDLVFTNWL 147

  Fly   462 IHHLATKERRLAALQEMARVLRPGG---------------------------------------- 486
            :.:|:.:| .:..:....|.||..|                                        
 Worm   148 MMYLSDEE-TVEFIFNCMRWLRSHGIVHLRESCSEPSTGRSKAKSMHDTANANPTHYRFSSLYIN 211

  Fly   487 --RALVY------VWAKDQRKNDKKSTYLRQ-------------------------NKAVNKERT 518
              ||:.|      :|..:.:.:....||:::                         |:.|...:.
 Worm   212 LLRAIRYRDVDNKLWRFNVQWSCSVPTYIKRSNNWRQVHWLAEKVPAEDGAKGTSFNELVELIKN 276

  Fly   519 TEQQQRQKQHQELEQQ---------------LSNNNPLPVHTNRTEFQQQDVLVPWKTKDEQKTT 568
            |.|.:::....:|:.:               |.:|:...::|.||       :.|          
 Worm   277 TWQNEQEAWDAKLDDEKYVWTDKVFSSALTSLPSNSTFFLYTPRT-------VSP---------- 324

  Fly   569 YLRYYHVFEEQELENLVSQVHEVQLIKSYY 598
               |.|:......|...:.|...::|..||
 Worm   325 ---YCHINAHTLAETFNANVWNTEIIPEYY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 23/145 (16%)
pmt-1NP_494991.1 PLN02336 39..>260 CDD:177970 34/229 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.