DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and ATPSCKMT

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_954584.2 Gene:ATPSCKMT / 134145 HGNCID:27029 Length:233 Species:Homo sapiens


Alignment Length:115 Identity:26/115 - (22%)
Similarity:41/115 - (35%) Gaps:38/115 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LSLSLQSDVVMDFRRGDDQVQVRLPRRSLLIMSGEARY--------DWTHGIRPKHIDVVPSASG 306
            ::.|..|:||:   .|..|:.::|.::....:..:||.        .||    |.|:    :..|
Human   149 VTFSQYSNVVI---FGVPQMMLQLEKKLERELEDDARVIACRFPFPHWT----PDHV----TGEG 202

  Fly   307 GLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTKVPQELHASLAAQA 356
            ..|..|   ..:.|||...|.||                ..:|..|..||
Human   203 IDTVWA---YDASTFRGREKRPC----------------TSMHFQLPIQA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 17/79 (22%)
Methyltransf_11 400..490 CDD:285453
ATPSCKMTNP_954584.2 Required for mitochondrial location. /evidence=ECO:0000269|PubMed:30530489 56..90
AdoMet_MTases 83..>188 CDD:388410 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.