DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and Prmt9

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001074709.1 Gene:Prmt9 / 102182 MGIID:2142651 Length:846 Species:Mus musculus


Alignment Length:412 Identity:83/412 - (20%)
Similarity:140/412 - (33%) Gaps:148/412 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LHIIADFVTEEEESTLLRAIGED------GRTSEVTGSLKHRNVKHFGFEFLYGTNNVDPSK-PL 194
            ||:       |.|..:::...:.      |..:|:..:|  .|::....|.|..|..::|:: .|
Mouse   472 LHL-------EHEMEVMKGFTKSKDLLSLGNEAELCSAL--ANLQTSRPEALEQTCMLEPTEIAL 527

  Fly   195 EQSIP---------------SACDILWP---------RLNSFASTWDW--SSPDQLTVNEYEPGH 233
            ..:||               .|.::||.         .:||.:...|.  |:.|...|.:...|.
Mouse   528 LNNIPYHEGFKTAMRKVLSSLAPELLWQPMDTHCQYMEMNSGSGQSDAAPSTADPFYVLDVSEGF 592

  Fly   234 GIPP-------HV--------DTHSAFLDPILSLSLQSDVVMDF--RRGDDQVQV-RLPRRSLLI 280
            .:.|       ||        |.|...||.|...:......::|  |..:|:..| :.|:...| 
Mouse   593 SLLPILAGTLGHVKPYSSVEKDQHCIALDLIAEANHFPKETLEFWLRHIEDEAAVLQRPKSDKL- 656

  Fly   281 MSGEARYDWTHGIRPKHIDVV-PSASGGLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTKV 344
                    |:..|    :||: ||   ||..|...::.:::...|:.|              .|:
Mouse   657 --------WSIII----LDVIEPS---GLIQQELMEKAAISRCLLQSG--------------GKI 692

  Fly   345 -PQ-ELHASLAAQAITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFE-PQSVVLDIGCGN 406
             || .|...:..::.||.:::.          ...|.||....::.|::.|: |..|.||:..  
Mouse   693 FPQYVLMFGMLVESQTLVEESA----------VQGTEHTLGLNIAPFINQFQVPIRVCLDLSS-- 745

  Fly   407 GKYLSCNPLLLSVGCDRAQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERR 471
               |.|.||...|                 .:.|.| |:.|..::|              .||.:
Mouse   746 ---LPCVPLSQPV-----------------ELLRLD-LMTPYLNTS--------------NKEVK 775

  Fly   472 LAALQEMARVLRPGGRALVYVW 493
            :       ||.|.|....|..|
Mouse   776 V-------RVCRSGRVTAVPFW 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 48/236 (20%)
Methyltransf_11 400..490 CDD:285453 18/89 (20%)
Prmt9NP_001074709.1 TPR 1 25..58
TPR 2 67..100
TPR_11 68..132 CDD:290150
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
TPR 3 101..134
AdoMet_MTases 148..>303 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.