DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17807 and kiaa1456l

DIOPT Version :9

Sequence 1:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_002934720.2 Gene:kiaa1456l / 100488302 XenbaseID:XB-GENE-985534 Length:445 Species:Xenopus tropicalis


Alignment Length:439 Identity:108/439 - (24%)
Similarity:162/439 - (36%) Gaps:179/439 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 QAITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLSV 419
            :|..||:|:||.||:..|.:|:|.:...||:|.:||...||.|:::|||||.|||||.|..:.::
 Frog     4 EATQLEKQHVHSVYESTAPYFNEVQSKAWPKVRQFLLEQEPGSLIVDIGCGTGKYLSVNSEIYNL 68

  Fly   420 GCDRAQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMARVLRP 484
            |||..:.|:.:.:.....|..||.|.:|.|....|..|||.||||.:||:||:.|::||||:|.|
 Frog    69 GCDYCKPLVEIAKNNKHEVMVCDNLNLPFRDQCFDTVISIGVIHHFSTKQRRIQAIKEMARILVP 133

  Fly   485 GGRALVYVWAKDQ--RKNDKKSTYLRQNKAVNKERTTEQQQRQKQ----HQELEQQLSN------ 537
            |||.::||||.:|  |:.:|:..::..|||:...|.:|..|.:.:    |.:..|.:..      
 Frog   134 GGRIMLYVWAMEQKSRRFEKQDVFVPWNKALLPRRPSETNQPENKININHNDKPQDMEGLERTEI 198

  Fly   538 ----------------------------------------------------------------- 537
                                                                             
 Frog   199 NNLGNSKQSHKMANCVSAEPCCITFANDENRLYSSIGRSLRSWFFSRSLDESSLRRHLDKMKCLS 263

  Fly   538 ------NNPLPV----------------------------------------------------- 543
                  |:|:.|                                                     
 Frog   264 QVGGWVNSPVSVQPTRHCSVDLGHERLFMKKHSFDDDVFIKNKSQNSTQWIIALNAGQNENGKFC 328

  Fly   544 -----------------HTNRTEFQQQDVLVPWKTKDEQKTT----------------------- 568
                             |:|.....:...|...|......||                       
 Frog   329 RLDPSDPKQASDQIEDKHSNYIGSNEDSQLAHCKLLKRTSTTESNDSILDETISVGEEENDHSDS 393

  Fly   569 --YLRYYHVFEEQELENLV-SQVHEVQLIKSYYDQGNHCAIFEKLSNNS 614
              ::||||||.|.||.||: :.|.|:|:..|.:|.||.|.|.||.:.::
 Frog   394 KAFMRYYHVFREGELSNLLETDVPELQITSSCFDHGNWCLIAEKKNTSN 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 43/89 (48%)
kiaa1456lXP_002934720.2 Methyltransf_25 48..135 CDD:379312 40/86 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434082at33208
OrthoFinder 1 1.000 - - FOG0001370
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X865
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.