DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33143 and FNDC4

DIOPT Version :9

Sequence 1:NP_001368934.1 Gene:CG33143 / 37583 FlyBaseID:FBgn0053143 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_073734.1 Gene:FNDC4 / 64838 HGNCID:20239 Length:234 Species:Homo sapiens


Alignment Length:205 Identity:50/205 - (24%)
Similarity:83/205 - (40%) Gaps:55/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLFVNACLAGTI----PATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTD------ 61
            ||.:.:|..|.:    |.:|.|:|||.|...:..|||..       |....::.|..:.      
Human    31 VLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDV-------PEGNIVIGYSISQQRQNGP 88

  Fly    62 -DRVVQDVAGSSEAIVLDRLLPSTQYSLVVTAIWQGKKYRSRGQIKFKTLD----LPKNTSQQDF 121
             .||:::|..::.|..|..|...:.|::.|.:|....:.....::.|:||.    ||.|:|.   
Human    89 GQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSS--- 150

  Fly   122 PPGIYGNSSNGARNVTNNASIFGDDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIA 186
             ||                     |:|       ..|...|.|...| |:.|:::||::||..|.
Human   151 -PG---------------------DIT-------VEGLDGERPLQTG-EVVIIVVVLLMWAAVIG 185

  Fly   187 LFFNRWGKIR 196
            ||..::..|:
Human   186 LFCRQYDIIK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33143NP_001368934.1 FN3 19..93 CDD:238020 20/80 (25%)
DUF4808 165..>230 CDD:374343 11/32 (34%)
DUF4808 <534..597 CDD:374343
FNDC4NP_073734.1 FN3 47..137 CDD:238020 22/96 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..160 12/69 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.