Sequence 1: | NP_001368934.1 | Gene: | CG33143 / 37583 | FlyBaseID: | FBgn0053143 | Length: | 813 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_073734.1 | Gene: | FNDC4 / 64838 | HGNCID: | 20239 | Length: | 234 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 50/205 - (24%) |
---|---|---|---|
Similarity: | 83/205 - (40%) | Gaps: | 55/205 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 VLFVNACLAGTI----PATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTD------ 61
Fly 62 -DRVVQDVAGSSEAIVLDRLLPSTQYSLVVTAIWQGKKYRSRGQIKFKTLD----LPKNTSQQDF 121
Fly 122 PPGIYGNSSNGARNVTNNASIFGDDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIA 186
Fly 187 LFFNRWGKIR 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33143 | NP_001368934.1 | FN3 | 19..93 | CDD:238020 | 20/80 (25%) |
DUF4808 | 165..>230 | CDD:374343 | 11/32 (34%) | ||
DUF4808 | <534..597 | CDD:374343 | |||
FNDC4 | NP_073734.1 | FN3 | 47..137 | CDD:238020 | 22/96 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 122..160 | 12/69 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 197..234 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |