DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33143 and fndc4a

DIOPT Version :9

Sequence 1:NP_001368934.1 Gene:CG33143 / 37583 FlyBaseID:FBgn0053143 Length:813 Species:Drosophila melanogaster
Sequence 2:XP_021324287.1 Gene:fndc4a / 567985 ZFINID:ZDB-GENE-041014-146 Length:220 Species:Danio rerio


Alignment Length:251 Identity:61/251 - (24%)
Similarity:100/251 - (39%) Gaps:61/251 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLIAVLFVNACLAGT--------IPATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKP 59
            ||:.|..|...|.|:        .|..|.|::|..|...:..|||:.       |....|:.:..
Zfish     4 VLVLVNSVGLLLFGSEMFLVGANRPPAPVNVSVMHLRADSATVSWEV-------PEGDIIIGFSI 61

  Fly    60 TDDRV-------VQDVAGSSEAIVLDRLLPSTQYSLVVTAIWQGKKYRSRGQIKFKTLDLPKNTS 117
            :..|:       :::|..:|.:.||..|...|.|.:.|.:|....:.::..::.|:||   |.|.
Zfish    62 SQQRMDGKMQRFIREVNTTSRSCVLWDLEEETDYIIQVQSIGLYGESQASKRVHFRTL---KKTD 123

  Fly   118 QQDFPPGIYGNSSNGARNVTNNASIFGDDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWA 182
            :  ||    .||||            .||.|....:...|..|.|:.        |:::||::||
Zfish   124 R--FP----SNSSN------------QDDPTVQGLDKARHLQTGEMI--------IIVVVLLMWA 162

  Fly   183 GAIALFFNRWGKIRMLLPYQPDYKHEQLKVPGTGVCS-----ASGCNGQHSHQCLP 233
            ..||||..::..|:     ..|..:.:.||..:...|     :.|......||.:|
Zfish   163 AVIALFCRQYDIIK-----DNDSSNSKEKVKPSSERSTPEHHSGGLLRSKFHQSVP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33143NP_001368934.1 FN3 19..93 CDD:238020 19/80 (24%)
DUF4808 165..>230 CDD:374343 15/69 (22%)
DUF4808 <534..597 CDD:374343
fndc4aXP_021324287.1 FN3 28..118 CDD:238020 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.