DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33143 and Fndc5

DIOPT Version :9

Sequence 1:NP_001368934.1 Gene:CG33143 / 37583 FlyBaseID:FBgn0053143 Length:813 Species:Drosophila melanogaster
Sequence 2:XP_006503275.1 Gene:Fndc5 / 384061 MGIID:1917614 Length:237 Species:Mus musculus


Alignment Length:197 Identity:49/197 - (24%)
Similarity:82/197 - (41%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTDDRV---VQDVAGSSEAIVLDRL 80
            |:.|.|:||..|...:..|||..   |:...:..:.::.:..|.|:   :|:|..::.:..|..|
Mouse    62 PSAPVNVTVRHLKANSAVVSWDV---LEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDL 123

  Fly    81 LPSTQYSLVVTAI-WQGKKYRSRGQIKFKTLDLPKNTSQQDFPPGIYGNSSNGARNVTNNASIFG 144
            ...|:|.:.|.|| .||:...|. .:.|||                       .|.....||...
Mouse   124 EEDTEYIVHVQAISIQGQSPASE-PVLFKT-----------------------PREAEKMASKNK 164

  Fly   145 DDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIALFFNRWGKIRMLLPYQPDYKHEQ 209
            |:||....     |..::|   |..|:.|:::||.:||   |||..::..|:   ..:|:...|:
Mouse   165 DEVTMKEM-----GRNQQL---RTGEVLIIVVVLFMWA---ALFCRQYDIIK---DNEPNNNKEK 215

  Fly   210 LK 211
            .|
Mouse   216 TK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33143NP_001368934.1 FN3 19..93 CDD:238020 19/76 (25%)
DUF4808 165..>230 CDD:374343 14/47 (30%)
DUF4808 <534..597 CDD:374343
Fndc5XP_006503275.1 FN3 62..152 CDD:238020 25/93 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.