Sequence 1: | NP_001368934.1 | Gene: | CG33143 / 37583 | FlyBaseID: | FBgn0053143 | Length: | 813 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006503275.1 | Gene: | Fndc5 / 384061 | MGIID: | 1917614 | Length: | 237 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 82/197 - (41%) | Gaps: | 45/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 PATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTDDRV---VQDVAGSSEAIVLDRL 80
Fly 81 LPSTQYSLVVTAI-WQGKKYRSRGQIKFKTLDLPKNTSQQDFPPGIYGNSSNGARNVTNNASIFG 144
Fly 145 DDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIALFFNRWGKIRMLLPYQPDYKHEQ 209
Fly 210 LK 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33143 | NP_001368934.1 | FN3 | 19..93 | CDD:238020 | 19/76 (25%) |
DUF4808 | 165..>230 | CDD:374343 | 14/47 (30%) | ||
DUF4808 | <534..597 | CDD:374343 | |||
Fndc5 | XP_006503275.1 | FN3 | 62..152 | CDD:238020 | 25/93 (27%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |