DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33143 and CG12541

DIOPT Version :9

Sequence 1:NP_001368934.1 Gene:CG33143 / 37583 FlyBaseID:FBgn0053143 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001036262.2 Gene:CG12541 / 31650 FlyBaseID:FBgn0029930 Length:263 Species:Drosophila melanogaster


Alignment Length:188 Identity:61/188 - (32%)
Similarity:80/188 - (42%) Gaps:43/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PPGIYGNSSNGARNVTN--NASIFGDDVTSTATNTLTHGTTREL-PTI--RGVEIGIVLIVLMVW 181
            ||.....||||:.:...  .:....|..|:.||...::.||.|. |.|  |..|:.||.:||::|
  Fly    71 PPSSSSASSNGSDDYLGELGSQEVDDGFTTGATTGASNATTVETGPKIIVRTEEVLIVGLVLVLW 135

  Fly   182 AGAIALFFNRWGKIRMLLPYQPDYKHEQLKVPGTGVCSASGCNGQHSHQCLPRCEGCGIFDRCFQ 246
            .|||.||||||||||||.||||.::.                  ||...| |..:    .|....
  Fly   136 VGAIMLFFNRWGKIRMLEPYQPKFQQ------------------QHRSSC-PLVD----LDAVTT 177

  Fly   247 YPRRELER-DCG---------CQFALLHKADVESXQPAHREAS-----SAAVSAASSH 289
            :.|..:.| ..|         ||||..:...... ..:|..||     |..|.|::||
  Fly   178 HQRSSVSRMSMGMVHNLNMPTCQFAAYNPNIYAKGYASHVSASRPRQNSVFVGASTSH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33143NP_001368934.1 FN3 19..93 CDD:238020
DUF4808 165..>230 CDD:374343 29/66 (44%)
DUF4808 <534..597 CDD:374343
CG12541NP_001036262.2 DUF4808 119..255 CDD:292684 46/140 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016571
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.