DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33143 and FNDC5

DIOPT Version :9

Sequence 1:NP_001368934.1 Gene:CG33143 / 37583 FlyBaseID:FBgn0053143 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_715637.2 Gene:FNDC5 / 252995 HGNCID:20240 Length:212 Species:Homo sapiens


Alignment Length:197 Identity:51/197 - (25%)
Similarity:84/197 - (42%) Gaps:42/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTDDRV---VQDVAGSSEAIVLDRL 80
            |:.|.|:||..|...:..|||..   |:...:..:.::.:..|.|:   :|:|..::.:..|..|
Human    34 PSAPVNVTVRHLKANSAVVSWDV---LEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDL 95

  Fly    81 LPSTQYSLVVTAI-WQGKKYRSRGQIKFKTLDLPKNTSQQDFPPGIYGNSSNGARNVTNNASIFG 144
            ...|:|.:.|.|| .||:...|. .:.|||                       .|.....||...
Human    96 EEDTEYIVHVQAISIQGQSPASE-PVLFKT-----------------------PREAEKMASKNK 136

  Fly   145 DDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIALFFNRWGKIRMLLPYQPDYKHEQ 209
            |:||....     |..::|   |..|:.|:::||.:|||.||||..::..|:   ..:|:...|:
Human   137 DEVTMKEM-----GRNQQL---RTGEVLIIVVVLFMWAGVIALFCRQYDIIK---DNEPNNNKEK 190

  Fly   210 LK 211
            .|
Human   191 TK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33143NP_001368934.1 FN3 19..93 CDD:238020 19/76 (25%)
DUF4808 165..>230 CDD:374343 16/47 (34%)
DUF4808 <534..597 CDD:374343
FNDC5NP_715637.2 FN3 34..124 CDD:238020 25/93 (27%)
DUF4808 151..>203 CDD:318317 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.