Sequence 1: | NP_001368934.1 | Gene: | CG33143 / 37583 | FlyBaseID: | FBgn0053143 | Length: | 813 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_715637.2 | Gene: | FNDC5 / 252995 | HGNCID: | 20240 | Length: | 212 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 84/197 - (42%) | Gaps: | 42/197 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 PATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTDDRV---VQDVAGSSEAIVLDRL 80
Fly 81 LPSTQYSLVVTAI-WQGKKYRSRGQIKFKTLDLPKNTSQQDFPPGIYGNSSNGARNVTNNASIFG 144
Fly 145 DDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIALFFNRWGKIRMLLPYQPDYKHEQ 209
Fly 210 LK 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33143 | NP_001368934.1 | FN3 | 19..93 | CDD:238020 | 19/76 (25%) |
DUF4808 | 165..>230 | CDD:374343 | 16/47 (34%) | ||
DUF4808 | <534..597 | CDD:374343 | |||
FNDC5 | NP_715637.2 | FN3 | 34..124 | CDD:238020 | 25/93 (27%) |
DUF4808 | 151..>203 | CDD:318317 | 16/45 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |