DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps20 and VPS20.2

DIOPT Version :9

Sequence 1:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_196488.1 Gene:VPS20.2 / 830785 AraportID:AT5G09260 Length:216 Species:Arabidopsis thaliana


Alignment Length:225 Identity:86/225 - (38%)
Similarity:135/225 - (60%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGALFGKTSKKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRAK 65
            ||.||.|..|      ||:.|:|:|.||.||.:|.|||:::|..:|.::..||..:::.|||||.
plant     1 MGNLFVKKPK------ITEVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIREKRKDRAL 59

  Fly    66 LLLRKKKYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERI 130
            |.|:||:.||.||...|:.|.|:|:..||||....:..|.:.||.||.|:|.:...:::|:|:::
plant    60 LALKKKRTQEELLKQVDQWLINVEQQLADIELTSKQKAVFESLKQGNNAIKAIQSEVNLDDVQKL 124

  Fly   131 MDETREGIEKQQEIDAILTDVLTTQDEEDVLAELDALEA----EEEQQKGAQLPDVPTEDLPIPA 191
            ||:|.|....|.|:.|||.:.|:.:|||::|||.|.||:    |:       :|:|||.:| :|.
plant   125 MDDTAEAKAYQDELSAILGEKLSAEDEEEILAEFDNLESLLIVED-------MPEVPTTEL-MPE 181

  Fly   192 EIESVEEP----------AKTKATKKVLVE 211
            |.|.::.|          .:|.:||:.::|
plant   182 EPEKMDLPDVPTKAPVASNETTSTKRKVLE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 68/167 (41%)
VPS20.2NP_196488.1 Snf7 16..177 CDD:397437 68/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1599
eggNOG 1 0.900 - - E1_KOG2910
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11607
Inparanoid 1 1.050 150 1.000 Inparanoid score I1718
OMA 1 1.010 - - QHG54090
OrthoDB 1 1.010 - - D1287094at2759
OrthoFinder 1 1.000 - - FOG0003546
OrthoInspector 1 1.000 - - otm3100
orthoMCL 1 0.900 - - OOG6_102807
Panther 1 1.100 - - LDO PTHR22761
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.