DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps20 and AT3G62080

DIOPT Version :9

Sequence 1:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001078328.1 Gene:AT3G62080 / 825381 AraportID:AT3G62080 Length:462 Species:Arabidopsis thaliana


Alignment Length:227 Identity:55/227 - (24%)
Similarity:104/227 - (45%) Gaps:38/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRA-------KLLL 68
            :||...|:..|..:|.|.:..::|:...:.::.:.|..:..|...|:.|.:..|       |::.
plant   248 QTALPGISTLDCDILHLLRTTEKLQDQLEVMDQRCEKSKKSALASLKSGHRKVALRHARELKVVT 312

  Fly    69 RKKKYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERIMDE 133
            ..::...|||...::.|..:    ||.|..::   |.:.:|.|...:|.:  .:..|:|...::|
plant   313 ESREKCTSLLNRVEEVLNTI----ADSESTKM---VSEAIKTGARVMKDI--KISADDVHDYLEE 368

  Fly   134 TREGIEKQQEIDAIL-----TDVLTTQDEEDVLAELDALEAEEEQQKGAQLP------DVPTE-- 185
            ..|.||.|::::..|     .|:    |:||:..||..||.:.|.:....||      |..||  
plant   369 LEETIESQKQVEKALESAPYPDI----DDEDIEEELLELEMDLESESSQVLPATSDTADSLTEMF 429

  Fly   186 -DLPIPAEIESVE----EPAKTKATKKVLVEA 212
             :|.:....:::|    |||:.|.:.|.::||
plant   430 SELKLGKTKQTLEEQATEPAQMKDSGKKILEA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 42/184 (23%)
AT3G62080NP_001078328.1 Snf7 261..395 CDD:304451 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.