DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps20 and chmp6b

DIOPT Version :9

Sequence 1:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001003874.1 Gene:chmp6b / 445397 ZFINID:ZDB-GENE-040924-2 Length:206 Species:Danio rerio


Alignment Length:206 Identity:114/206 - (55%)
Similarity:152/206 - (73%) Gaps:13/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGALFGKTSKKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRAK 65
            ||.||||  ||.  :|:|:||:||||||||||:||||||||..|::.:|.||::.|:.|:||:|.
Zfish     1 MGNLFGK--KKA--TRVTEQDRAVLQLKQQRDKLKQYQKRITLQMDKERQLAKQLLKDGKKDKAL 61

  Fly    66 LLLRKKKYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERI 130
            |||:||:||:.||...:.|:.|||::..||||||:||||::|||.||..|||:||:|.|:|||:|
Zfish    62 LLLKKKRYQDQLLEKTENQISNLERMVQDIEFAQIEMKVIEGLKVGNDCLKKMHEVLSIEEVEKI 126

  Fly   131 MDETREGIEKQQEIDAILTDVLTTQDEEDVLAELDAL---EAEEEQQKGAQLPDVPTEDLPIPAE 192
            ||||.:.||.|::||.:|...||.:|||.|||||:|:   ||:.|      ||:||.|:||...|
Zfish   127 MDETHDAIEYQKQIDEMLAGSLTQEDEEAVLAELEAITHGEADLE------LPEVPGEELPEVPE 185

  Fly   193 IESVEEPAKTK 203
            .|.|.|..:.|
Zfish   186 QEPVREKERVK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 94/166 (57%)
chmp6bNP_001003874.1 Snf7 18..179 CDD:304451 94/166 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..206 15/36 (42%)
Type-2 MIT-interacting motif. /evidence=ECO:0000250 170..181 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586314
Domainoid 1 1.000 187 1.000 Domainoid score I3268
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11607
Inparanoid 1 1.050 212 1.000 Inparanoid score I3625
OMA 1 1.010 - - QHG54090
OrthoDB 1 1.010 - - D1287094at2759
OrthoFinder 1 1.000 - - FOG0003546
OrthoInspector 1 1.000 - - otm25271
orthoMCL 1 0.900 - - OOG6_102807
Panther 1 1.100 - - LDO PTHR22761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5973
SonicParanoid 1 1.000 - - X4514
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.