DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps20 and shrb

DIOPT Version :9

Sequence 1:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster


Alignment Length:224 Identity:68/224 - (30%)
Similarity:112/224 - (50%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GALFGKTSKKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRAKL 66
            |.:|| ..|:.||:    ..:|:.:|::..:.|.:.|:.:|.::|::..:|||...:.:: .|..
  Fly     5 GKMFG-GKKEVAPT----TGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKR-VALQ 63

  Fly    67 LLRKKKYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERIM 131
            .|:|||..|..|...|..|..:|.....:|.|.....||..:|....|||:.|:.:|:|:|..:|
  Fly    64 ALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMM 128

  Fly   132 DETREGIEKQQEIDAILTDVLTTQ-------DEEDVLAELDALEAEEEQQK-------GAQLPDV 182
            |:    |.:||::...::|.::..       |:||:..|||.||.|...::       ...||:.
  Fly   129 DD----IAEQQDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEIIGIPEPTPTLPEA 189

  Fly   183 PTEDLPIPAEIESVEEPAKTKATKKVLVE 211
            ||||||     |..:|  |.|||....||
  Fly   190 PTEDLP-----EKAKE--KKKATTTTAVE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 50/177 (28%)
shrbNP_610462.3 Snf7 20..193 CDD:281366 50/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.